Skip to Main content Skip to Navigation

Caractérisation d'une forme extracellulaire soluble de la protéase PrtS chez Streptococcus thermophilus 4F44. Mise en évidence et détermination de ses sites de coupure sur les caséines

Abstract : Among 30 strains, only 4F44 strain releases a activity in the medium which does not results from the presence of intracellular protease due to cell lysis. This soluble protease is PrtS in two forms (non mature and mature), 60% as anchored to cell wall and 40% as released in the medium. The protein sequence deduced from the gene is slightly different to those of LMD-9 (97% identity), CNRZ385 (98%), JIM8232 (96%), S. suis (97%). The protein sequence of the anchor domain including LPNTG is conserved as for LMD-9, CNRZ385 and S. suis ; so this PrtS might be anchored to peptidoglycan by sortase A (SrtA).In 4F44, the absence of an imperfect duplication of a peptide sequence at prodomain of PrtS could explain the partial liberation, furthermore, the LMD-9 strain which presents this duplication possess the protease PrtS only the anchored form.Comparison of protein sequence deduced from the srtA gene in 4F44, ND03, LMD-9, PB18O, PB302 and CNRZ307 strains showed that the residues of the catalytic and active sites are conserved. Six amino acids are different for 4F44, I222 replaced by a V222 possibly leads to the partial liberation of PrtS. The trypsic C-ter peptides QVTQLPNTGENDTK and QVTQLPNTGENDTKYYLVPGVIIGLGTLLVSIRR have been identified by MS/MS, indicating that the peptide bond of T and G (target of endopeptidasic activity of Srt A) is not hydrolyzed.?-casein is preferentially degraded in comparison to other caseins. Soluble PrtS has a broad specificity against A, L, M, F, Y, W, V, S, T, N, Q, R, H and K at position P1. Globally, it releases 33 bioactive peptides (antihypertensives, mitogenics, oipoide, immunomodulantors, antimicrobials, antioxydants, antimutagens)
Document type :
Complete list of metadatas

Cited literature [225 references]  Display  Hide  Download
Contributor : Thèses Ul <>
Submitted on : Thursday, March 29, 2018 - 12:16:31 PM
Last modification on : Tuesday, March 17, 2020 - 3:07:29 AM
Long-term archiving on: : Friday, September 14, 2018 - 7:35:20 PM


Files produced by the author(s)


  • HAL Id : tel-01749448, version 1


Oun Ki Chang. Caractérisation d'une forme extracellulaire soluble de la protéase PrtS chez Streptococcus thermophilus 4F44. Mise en évidence et détermination de ses sites de coupure sur les caséines. Sciences agricoles. Institut National Polytechnique de Lorraine, 2011. Français. ⟨NNT : 2011INPL065N⟩. ⟨tel-01749448⟩



Record views


Files downloads